Clicky

The occupants of this housing room were constant from 120 to 30 d prior to presentation and consisted primarily of animals that had received TBI. (1998) found that rhesus LCV did not immortalize human B cells, and human EBV could not immortalize rhesus monkey B cells (Moghaddam et al., 1998). Antibody-positive serum pools from baboons, langurs, sooty mangabeys, and African green monkeys infected with herpesvirus papio 2, herpes virus langur, mangabey herpesvirus, and simian agent 8, respectively, were described and characterized previously (29). As additional sequence pairs are added to the alignment, the total number of sequence differences increases, but the ability to discriminate between isolate-specific and subtype-specific differences also increases. 1) and other restriction endonucleases (data not shown). However, they were least efficient for EEHV3. (A) Neonatal (6 d) vervet monkey shows a myriad of primordial follicles characterized by a flattened single granulosa cell layer and occasional apoptotic oocytes …

Unlike the human and Old World monkey viruses, the UL region of the HVS1 genome is not flanked by inverted repeat sequences (analogous to the “b” repeats of HSV-1). To address this need, another ED50 value was calculated for the GCV and CDV doses that protected against severe neurologic involvement as defined by paralysis of the ipsilateral hindleg (a score of 3). Reactivity of recombinant gD to monkey sera in RIPA. Despite their common use in biomedical research, rhesus macaques have only infrequently been reported for spontaneous varicella infection in the scientific literature.10,19 Rhesus macaques may have decreased sensitivity to infection,6 because most reported outbreaks have involved patas and African green monkeys and cynomolgus, bonnet, and pigtail macaques.9 In the outbreak described here, no lesions were identified in cynomolgus macaques housed in the same room, nor were any abnormalities reported in macaques housed in other rooms in the facility. Because SIV-infected Asian macaques (with rare exception) progress to a terminal disease state, such animals must be culled immediately from all SPF colonies. Demographic and serologic data were entered into a spreadsheet, and univariate analysis was performed with the JUMP-IN 4 statistical software package (SAS Institute, Inc., Cary, NC, USA). Cage height should consider the length of the animal’s tail so that it will not touch the floor when the animal is sitting on a perch (NRC 1996).

Direct sequence alignment further illustrates that although EBV TK and CeHV-15 TK are 89% identical overall, even among these closely related lymphocryptoviruses, similarity remains greatest in the C-terminal kinase domain (Fig. Agricultural Bioterrorism Protection Act of 2002; Possession, Use, and Transfer of Biological Agents and Toxins. LCV has been associated with lymphoproliferative disorders in cynomolgus macaques after solid organ transplantation in a process analogous to PTLD in human patients. 2399-2460. This homology includes a putative conserved zinc finger motif at predicted positions 491 to 502 (CDLCDVETRHVC; Zn finger consensus sequence is C- X2-5-C-X2-15-C/H-X2-4-C/H, where bold indicates conserved residues) (11), followed by a putative conserved DNA binding domain (R795AEKVMQLQPILNGPHGYLLKRFHERLFPTN KAISAMAFWNRAQNNK; the UL29 DNA binding consensus motif is K/R-X2-3-K/R-X9-10-F-X4-F-X1-3-K/R-X10-12-W-X6-R (16). Others of the 55 coding region CACACA sequences may act in the same or a similar way. Proteins were excised from the gel and digested in situ with trypsin.

Both RL and RS of LHV-4 are much shorter than those of other annotated simplexviruses. Eight percent polyacrylamide gels were used for electrophoresis and run at 250 to 300 V at 4°C for 2 to 4½ hours. It means that those “ancient” genes had been inserted in viral genomes from the host genomes (captured by viruses) somewhere in time. Human spumavirus (6) and torque teno virus (a member of Circoviridae that infects humans) (7) appear to follow this strategy. Although the length of the BatBHV-1 sequence was short, similarity between BatBHV-1 and BatBHV-2 was relatively high (58%). RNA structure within introns can alter accessibility or distance between functional elements and thus regulate splicing [59]. Plasmid DNA was end sequenced, and clones of interest fully sequenced.

We have used the Luminex-based assays to screen for rhadinovirus infection in macaques at the WaNPRC and have followed the immunoreactivity to multiple viral antigens longitudinally during natural infections. In second-round PCR, one sense and one antisense primer (TGV and IYG, respectively) were used (Fig. AAALAC International recognizes that the biomedical or agricultural research, testing or teaching objectives as well as the health and welfare of the animals will dictate when application of the recommendations of the Ag Guide, ILAR Guide, or ETS 123 is most appropriate. Indeed, when we attempted to use the above algorithms on some herpesviruses genomes with known replication origins like those listed in Table 5 of [10], a variety of difficulties were encountered. She was a member of the Studio Dance Theater, Outdoors Club, Circle K International, and volunteered for Habitat for Humanity. Understanding why some viruses are able to cross the species barrier and produce serious disease in non-natural hosts while others cannot is central to being able to treat and even prevent such infections.